CCDC87 Antikörper (N-Term)

Produktnummer ABIN632942

Produktdetails anti-CCDC87 Antikörper

Target: CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC87 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC87 antibody was raised against the N terminal of CCDC87

Aufreinigung: Affinity purified

Immunogen: CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC87 Blocking Peptide, catalog no. 33R-6230, is also available for use as a blocking control in assays to test for specificity of this CCDC87 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC87 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC87

Target: CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))

Andere Bezeichnung: CCDC87 (CCDC87 Produkte)

Synonyme: 4931419P11Rik antikoerper, coiled-coil domain containing 87 antikoerper, CCDC87 antikoerper, Ccdc87 antikoerper

Hintergrund: The function of CCDC87 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 96 kDa (MW of target protein)