CCDC87 Antikörper (N-Term)
-
- Target Alle CCDC87 Antikörper anzeigen
- CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCDC87 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CCDC87 antibody was raised against the N terminal of CCDC87
- Aufreinigung
- Affinity purified
- Immunogen
- CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL
- Top Product
- Discover our top product CCDC87 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCDC87 Blocking Peptide, catalog no. 33R-6230, is also available for use as a blocking control in assays to test for specificity of this CCDC87 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC87 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))
- Andere Bezeichnung
- CCDC87 (CCDC87 Produkte)
- Synonyme
- 4931419P11Rik antikoerper, coiled-coil domain containing 87 antikoerper, CCDC87 antikoerper, Ccdc87 antikoerper
- Hintergrund
- The function of CCDC87 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 96 kDa (MW of target protein)
-