RIC8B Antikörper

Produktnummer ABIN632939

Produktdetails anti-RIC8B Antikörper

Target: RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RIC8B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RIC8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RIC8B Blocking Peptide, catalog no. 33R-3821, is also available for use as a blocking control in assays to test for specificity of this RIC8B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RIC8B

Target: RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))

Andere Bezeichnung: RIC8B (RIC8B Produkte)

Synonyme: DKFZp469H2225 antikoerper, BC051080 antikoerper, Ric-8 antikoerper, Ric-8b antikoerper, RIC8 antikoerper, hSyn antikoerper, RIC8 guanine nucleotide exchange factor B antikoerper, RIC8B antikoerper, Ric8b antikoerper

Hintergrund: RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling