DNAAF2 Antikörper (N-Term)
-
- Target Alle DNAAF2 (C14orf104) Antikörper anzeigen
- DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAAF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C14 ORF104 antibody was raised against the N terminal Of C14 rf104
- Aufreinigung
- Affinity purified
- Immunogen
- C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C14ORF104 Blocking Peptide, catalog no. 33R-6005, is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF104 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))
- Andere Bezeichnung
- C14ORF104 (C14orf104 Produkte)
- Hintergrund
- This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 91 kDa (MW of target protein)
-