MAP7D1 Antikörper (N-Term)

Produktnummer ABIN632935

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MAP7D1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MAP7D1 Antikörper (N-Term) (ABIN632935)

Target: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP7D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAP7D1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MAP7 D1 antibody was raised against the N terminal of MAP7 1

Aufreinigung: Affinity purified

Immunogen: MAP7 D1 antibody was raised using the N terminal of MAP7 1 corresponding to a region with amino acids RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP7D1 Blocking Peptide, (ABIN5614659), is also available for use as a blocking control in assays to test for specificity of this MAP7D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP7D1

Target: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Andere Bezeichnung: MAP7D1

Hintergrund: The function of MAP7 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 93 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion