SLFN12 Antikörper (N-Term)

Produktnummer ABIN632933

Der Kaninchen Polyklonal Anti-SLFN12-Antikörper wurde für WB validiert. Er ist geeignet, SLFN12 in Proben von Human zu detektieren.

Kurzübersicht für SLFN12 Antikörper (N-Term) (ABIN632933)

Target: SLFN12 (Schlafen Family Member 12 (SLFN12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLFN12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLFN12 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLFN12 antibody was raised against the N terminal of SLFN12

Aufreinigung: Affinity purified

Immunogen: SLFN12 antibody was raised using the N terminal of SLFN12 corresponding to a region with amino acids KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLFN12 Blocking Peptide, catalog no. 33R-4534, is also available for use as a blocking control in assays to test for specificity of this SLFN12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFN12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLFN12

Target: SLFN12 (Schlafen Family Member 12 (SLFN12))

Andere Bezeichnung: SLFN12

Hintergrund: The function of SLFN12 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 67 kDa (MW of target protein)