CNOT11 Antikörper (N-Term)

Produktnummer ABIN632925

Der Kaninchen Polyklonal anti-CNOT11 Antikörper (ABIN632925) detektiert spezifisch CNOT11 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für CNOT11 Antikörper (N-Term) (ABIN632925)

Target: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNOT11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CNOT11 Antikörper

Bindungsspezifität: N-Term

Spezifität: C2 ORF29 antibody was raised against the N terminal Of C2 rf29

Aufreinigung: Affinity purified

Immunogen: C2 ORF29 antibody was raised using the N terminal Of C2 rf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C2ORF29 Blocking Peptide, (ABIN5612501), is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNOT11

Target: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Andere Bezeichnung: C2ORF29

Hintergrund: The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 55 kDa (MW of target protein)