CNOT11 Antikörper (N-Term)

Produktnummer ABIN632925

Produktdetails anti-CNOT11 Antikörper

Target: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNOT11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C2 ORF29 antibody was raised against the N terminal Of C2 rf29

Aufreinigung: Affinity purified

Immunogen: C2 ORF29 antibody was raised using the N terminal Of C2 rf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C2ORF29 Blocking Peptide, catalog no. 33R-6815, is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNOT11

Target: CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))

Andere Bezeichnung: C2ORF29 (CNOT11 Produkte)

Synonyme: C2orf29 antikoerper, 2410015L18Rik antikoerper, C40 antikoerper, D1Bwg0212e antikoerper, RGD1560909 antikoerper, fj49e01 antikoerper, wu:fj49e01 antikoerper, zgc:163002 antikoerper, CCR4-NOT transcription complex subunit 11 antikoerper, CCR4-NOT transcription complex, subunit 11 antikoerper, CNOT11 antikoerper, Cnot11 antikoerper, cnot11 antikoerper

Hintergrund: The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 55 kDa (MW of target protein)