CNOT11 Antikörper (N-Term)
-
- Target Alle CNOT11 Antikörper anzeigen
- CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CNOT11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C2 ORF29 antibody was raised against the N terminal Of C2 rf29
- Aufreinigung
- Affinity purified
- Immunogen
- C2 ORF29 antibody was raised using the N terminal Of C2 rf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C2ORF29 Blocking Peptide, catalog no. 33R-6815, is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNOT11 (CCR4-NOT Transcription Complex, Subunit 11 (CNOT11))
- Andere Bezeichnung
- C2ORF29 (CNOT11 Produkte)
- Hintergrund
- The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 55 kDa (MW of target protein)
-