CXorf26 Antikörper (Middle Region)

Produktnummer ABIN632923

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch CXorf26 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CXorf26 Antikörper (Middle Region) (ABIN632923)

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXorf26 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CXorf26 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CXORF26 antibody was raised against the middle region of Cxorf26

Aufreinigung: Affinity purified

Immunogen: CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXORF26 Blocking Peptide, (ABIN939612), is also available for use as a blocking control in assays to test for specificity of this CXORF26 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF26 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CXorf26

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Andere Bezeichnung: CXORF26

Hintergrund: The function of Chromosome X ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 26 kDa (MW of target protein)