C20orf111 Antikörper (N-Term)

Produktnummer ABIN632921

Der Kaninchen Polyklonal Anti-C20orf111-Antikörper wurde für WB validiert. Er ist geeignet, C20orf111 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für C20orf111 Antikörper (N-Term) (ABIN632921)

Target: C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C20orf111 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C20orf111 Antikörper

Bindungsspezifität: N-Term

Spezifität: C20 ORF111 antibody was raised against the N terminal Of C20 rf111

Aufreinigung: Affinity purified

Immunogen: C20 ORF111 antibody was raised using the N terminal Of C20 rf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF111 Blocking Peptide, (ABIN5612475), is also available for use as a blocking control in assays to test for specificity of this C20ORF111 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF111 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C20orf111

Target: C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))

Andere Bezeichnung: C20ORF111

Hintergrund: The function of Chromosome 20 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 32 kDa (MW of target protein)