MED31 Antikörper (N-Term)

Produktnummer ABIN632918

Produktdetails anti-MED31 Antikörper

Target: MED31 (Mediator Complex Subunit 31 (MED31))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MED31 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MED31 antibody was raised against the N terminal of MED31

Aufreinigung: Affinity purified

Immunogen: MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MED31 Blocking Peptide, catalog no. 33R-5587, is also available for use as a blocking control in assays to test for specificity of this MED31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MED31

Target: MED31 (Mediator Complex Subunit 31 (MED31))

Andere Bezeichnung: MED31 (MED31 Produkte)

Synonyme: 3110004H13Rik antikoerper, Soh1 antikoerper, CGI-125 antikoerper, l11Jus15 antikoerper, RGD1309457 antikoerper, fa04d01 antikoerper, zgc:92673 antikoerper, wu:fa04d01 antikoerper, CaO19.1429 antikoerper, cgi-125 antikoerper, med31 antikoerper, med31-a antikoerper, med31-b antikoerper, med31a antikoerper, soh1 antikoerper, soh1-A antikoerper, mediator complex subunit 31 antikoerper, Soh1p antikoerper, mediator complex subunit Med31 antikoerper, mediator complex subunit 31 L homeolog antikoerper, MED31 antikoerper, Med31 antikoerper, med31 antikoerper, SOH1 antikoerper, med31.L antikoerper

Hintergrund: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha