TPRKB Antikörper (Middle Region)

Produktnummer ABIN632917

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TPRKB in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für TPRKB Antikörper (Middle Region) (ABIN632917)

Target: TPRKB (TP53RK Binding Protein (TPRKB))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPRKB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TPRKB Antikörper

Bindungsspezifität: Middle Region

Spezifität: TPRKB antibody was raised against the middle region of TPRKB

Aufreinigung: Affinity purified

Immunogen: TPRKB antibody was raised using the middle region of TPRKB corresponding to a region with amino acids EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPRKB Blocking Peptide, (ABIN937833), is also available for use as a blocking control in assays to test for specificity of this TPRKB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPRKB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPRKB

Target: TPRKB (TP53RK Binding Protein (TPRKB))

Andere Bezeichnung: TPRKB

Hintergrund: The function of TPRKB protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 20 kDa (MW of target protein)