Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

RPS27L Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPS27L in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.
Produktnummer ABIN632914

Kurzübersicht für RPS27L Antikörper (N-Term) (ABIN632914)

Target

Alle RPS27L Antikörper anzeigen
RPS27L (Ribosomal Protein S27L (RPS27L))

Reaktivität

  • 19
  • 16
  • 12
  • 4
  • 4
  • 3
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 19
Kaninchen

Klonalität

  • 19
Polyklonal

Konjugat

  • 12
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser RPS27L Antikörper ist unkonjugiert

Applikation

  • 12
  • 6
  • 4
  • 2
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 6
    • 3
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    RPS27 L antibody was raised against the N terminal of RPS27

    Aufreinigung

    Affinity purified

    Immunogen

    RPS27 L antibody was raised using the N terminal of RPS27 corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    RPS27L Blocking Peptide, (ABIN5615950), is also available for use as a blocking control in assays to test for specificity of this RPS27L antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS20 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    RPS27L (Ribosomal Protein S27L (RPS27L))

    Andere Bezeichnung

    RPS27L

    Hintergrund

    This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

    Molekulargewicht

    9 kDa (MW of target protein)

    Pathways

    Positive Regulation of Endopeptidase Activity
Sie sind hier:
Chat with us!