C22orf28 Antikörper (N-Term)

Produktnummer ABIN632911

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch C22orf28 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für C22orf28 Antikörper (N-Term) (ABIN632911)

Target: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C22orf28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C22orf28 Antikörper

Bindungsspezifität: N-Term

Spezifität: C22 ORF28 antibody was raised against the N terminal Of C22 rf28

Aufreinigung: Affinity purified

Immunogen: C22 ORF28 antibody was raised using the N terminal Of C22 rf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C22ORF28 Blocking Peptide, (ABIN5612497), is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C22orf28

Target: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Andere Bezeichnung: C22ORF28

Hintergrund: C22ORF28 is believed to be involved in vinculin binding.

Molekulargewicht: 55 kDa (MW of target protein)