MFAP1 Antikörper (Middle Region)

Produktnummer ABIN632905

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MFAP1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für MFAP1 Antikörper (Middle Region) (ABIN632905)

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MFAP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MFAP1 antibody was raised against the middle region of MFAP1

Aufreinigung: Affinity purified

Immunogen: MFAP1 antibody was raised using the middle region of MFAP1 corresponding to a region with amino acids TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFAP1 Blocking Peptide, (ABIN5614734), is also available for use as a blocking control in assays to test for specificity of this MFAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFAP1

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Andere Bezeichnung: MFAP1

Hintergrund: MFAP1 is a component of the elastin-associated microfibrils.

Molekulargewicht: 52 kDa (MW of target protein)