MFAP1 Antikörper (Middle Region)

Produktnummer ABIN632905

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MFAP1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MFAP1 Antikörper (Middle Region) (ABIN632905)

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MFAP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MFAP1 antibody was raised against the middle region of MFAP1

Aufreinigung: Affinity purified

Immunogen: MFAP1 antibody was raised using the middle region of MFAP1 corresponding to a region with amino acids TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFAP1 Blocking Peptide, (ABIN5614734), is also available for use as a blocking control in assays to test for specificity of this MFAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFAP1

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Andere Bezeichnung: MFAP1

Hintergrund: MFAP1 is a component of the elastin-associated microfibrils.

Molekulargewicht: 52 kDa (MW of target protein)