PSMA5 Antikörper

Produktnummer ABIN632898

Dieser Anti-PSMA5-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von PSMA5 in WB. Geeignet für Human, Maus, Ratte, Drosophila melanogaster und C. elegans.

Kurzübersicht für PSMA5 Antikörper (ABIN632898)

Target: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PSMA5 Antikörper

Aufreinigung: Affinity purified

Immunogen: PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMA5 Blocking Peptide, (ABIN5615623), is also available for use as a blocking control in assays to test for specificity of this PSMA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMA5

Target: PSMA5 (Proteasome Subunit alpha 5 (PSMA5))

Andere Bezeichnung: PSMA5

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA