OAZ2 Antikörper (Middle Region)

Produktnummer ABIN632895

Produktdetails anti-OAZ2 Antikörper

Target: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OAZ2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OAZ2 antibody was raised against the middle region of OAZ2

Aufreinigung: Affinity purified

Immunogen: OAZ2 antibody was raised using the middle region of OAZ2 corresponding to a region with amino acids PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OAZ2 Blocking Peptide, catalog no. 33R-7012, is also available for use as a blocking control in assays to test for specificity of this OAZ2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAZ2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OAZ2

Target: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Andere Bezeichnung: OAZ2 (OAZ2 Produkte)

Synonyme: AZ2 antikoerper, AZ-2 antikoerper, Oaz2-ps antikoerper, Sez15 antikoerper, AZL antikoerper, oaz2 antikoerper, wu:fa14f04 antikoerper, zgc:63816 antikoerper, RGD1562933 antikoerper, si:dkey-275p19.6 antikoerper, ornithine decarboxylase antizyme 2 antikoerper, ornithine decarboxylase antizyme 1b antikoerper, ornithine decarboxylase antizyme 2 S homeolog antikoerper, ornithine decarboxylase antizyme 2a antikoerper, OAZ2 antikoerper, Oaz2 antikoerper, oaz1b antikoerper, oaz2.S antikoerper, Tsp_12111 antikoerper, oaz2 antikoerper, oaz2a antikoerper

Hintergrund: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis.

Molekulargewicht: 21 kDa (MW of target protein)