TBC1D25 Antikörper (N-Term)

Produktnummer ABIN632894

Produktdetails anti-TBC1D25 Antikörper

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBC1 D25 antibody was raised against the N terminal of TBC1 25

Aufreinigung: Affinity purified

Immunogen: TBC1 D25 antibody was raised using the N terminal of TBC1 25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D25 Blocking Peptide, catalog no. 33R-4721, is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D25

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Andere Bezeichnung: TBC1D25 (TBC1D25 Produkte)

Synonyme: im:7137114 antikoerper, si:dkeyp-22b2.2 antikoerper, MG81 antikoerper, OATL1 antikoerper, 6330576A08Rik antikoerper, A530047E07 antikoerper, DXHXS7927e antikoerper, Oatl1 antikoerper, mMg81 antikoerper, RGD1559711 antikoerper, TBC1 domain family member 25 antikoerper, TBC1 domain family, member 25 antikoerper, TBC1D25 antikoerper, tbc1d25 antikoerper, Tbc1d25 antikoerper

Hintergrund: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Molekulargewicht: 76 kDa (MW of target protein)