TBC1D25 Antikörper (N-Term)

Produktnummer ABIN632894

Der Kaninchen Polyklonal Anti-TBC1D25-Antikörper wurde für WB validiert. Er ist geeignet, TBC1D25 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für TBC1D25 Antikörper (N-Term) (ABIN632894)

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TBC1D25 Antikörper

Bindungsspezifität: N-Term

Spezifität: TBC1 D25 antibody was raised against the N terminal of TBC1 25

Aufreinigung: Affinity purified

Immunogen: TBC1 D25 antibody was raised using the N terminal of TBC1 25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D25 Blocking Peptide, (ABIN940107), is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D25

Target: TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))

Andere Bezeichnung: TBC1D25

Hintergrund: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Molekulargewicht: 76 kDa (MW of target protein)