RALGDS Antikörper (N-Term)

Produktnummer ABIN632886

Produktdetails anti-RALGDS Antikörper

Target: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RALGDS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RALGDS antibody was raised against the N terminal of RALGDS

Aufreinigung: Affinity purified

Immunogen: RALGDS antibody was raised using the N terminal of RALGDS corresponding to a region with amino acids KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RALGDS Blocking Peptide, catalog no. 33R-4641, is also available for use as a blocking control in assays to test for specificity of this RALGDS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGDS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RALGDS

Target: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Andere Bezeichnung: RALGDS (RALGDS Produkte)

Synonyme: RGDS antikoerper, RGF antikoerper, RalGEF antikoerper, Gnds antikoerper, Rgds antikoerper, mKIAA1308 antikoerper, RALGDS antikoerper, ral guanine nucleotide dissociation stimulator antikoerper, RALGDS antikoerper, Ralgds antikoerper, ralgds antikoerper

Hintergrund: The function of RALGDS protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung