RALGDS Antikörper (N-Term)

Produktnummer ABIN632886

Der Kaninchen Polyklonal anti-RALGDS Antikörper (ABIN632886) detektiert spezifisch RALGDS in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für RALGDS Antikörper (N-Term) (ABIN632886)

Target: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RALGDS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RALGDS Antikörper

Bindungsspezifität: N-Term

Spezifität: RALGDS antibody was raised against the N terminal of RALGDS

Aufreinigung: Affinity purified

Immunogen: RALGDS antibody was raised using the N terminal of RALGDS corresponding to a region with amino acids KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RALGDS Blocking Peptide, (ABIN940027), is also available for use as a blocking control in assays to test for specificity of this RALGDS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGDS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RALGDS

Target: RALGDS (Ral Guanine Nucleotide Dissociation Stimulator (RALGDS))

Andere Bezeichnung: RALGDS

Hintergrund: The function of RALGDS protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung