OLAH Antikörper (N-Term)

Produktnummer ABIN632883

Produktdetails anti-OLAH Antikörper

Target: OLAH (Oleoyl-ACP Hydrolase (OLAH))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLAH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OLAH antibody was raised against the N terminal of OLAH

Aufreinigung: Affinity purified

Immunogen: OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OLAH Blocking Peptide, catalog no. 33R-6029, is also available for use as a blocking control in assays to test for specificity of this OLAH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLAH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OLAH

Target: OLAH (Oleoyl-ACP Hydrolase (OLAH))

Andere Bezeichnung: OLAH (OLAH Produkte)

Synonyme: thedc1 antikoerper, THEDC1 antikoerper, AURA1 antikoerper, SAST antikoerper, AI607300 antikoerper, E230009B14Rik antikoerper, Thedc1 antikoerper, Mch antikoerper, oleoyl-ACP hydrolase antikoerper, S-acyl fatty acid synthase thioesterase, medium chain antikoerper, olah antikoerper, OLAH antikoerper, LOC100349940 antikoerper, Olah antikoerper

Hintergrund: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex.

Molekulargewicht: 30 kDa (MW of target protein)