OLAH Antikörper (N-Term)
Kurzübersicht für OLAH Antikörper (N-Term) (ABIN632883)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- OLAH antibody was raised against the N terminal of OLAH
-
Aufreinigung
- Affinity purified
-
Immunogen
- OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
OLAH Blocking Peptide, (ABIN5615118), is also available for use as a blocking control in assays to test for specificity of this OLAH antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLAH antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- OLAH (Oleoyl-ACP Hydrolase (OLAH))
-
Andere Bezeichnung
- OLAH
-
Hintergrund
- OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex.
-
Molekulargewicht
- 30 kDa (MW of target protein)
Target
-