OLAH Antikörper (N-Term)
-
- Target Alle OLAH Produkte
- OLAH (Oleoyl-ACP Hydrolase (OLAH))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OLAH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OLAH antibody was raised against the N terminal of OLAH
- Aufreinigung
- Affinity purified
- Immunogen
- OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OLAH Blocking Peptide, catalog no. 33R-6029, is also available for use as a blocking control in assays to test for specificity of this OLAH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLAH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OLAH (Oleoyl-ACP Hydrolase (OLAH))
- Andere Bezeichnung
- OLAH (OLAH Produkte)
- Hintergrund
- OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex.
- Molekulargewicht
- 30 kDa (MW of target protein)
-