C9orf68 Antikörper (Middle Region)

Produktnummer ABIN632882

Produktdetails anti-C9orf68 Antikörper

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C9orf68 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C9 ORF68 antibody was raised against the middle region of C9 rf68

Aufreinigung: Affinity purified

Immunogen: C9 ORF68 antibody was raised using the middle region of C9 rf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF68 Blocking Peptide, catalog no. 33R-1733, is also available for use as a blocking control in assays to test for specificity of this C9ORF68 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF68 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C9orf68

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Andere Bezeichnung: C9ORF68 (C9orf68 Produkte)

Synonyme: MGC131199 antikoerper, MGC146453 antikoerper, C9orf68 antikoerper, bA6J24.2 antikoerper, spermatogenesis associated 6-like L homeolog antikoerper, spermatogenesis associated 6-like antikoerper, spermatogenesis associated 6 like antikoerper, spata6l.L antikoerper, spata6l antikoerper, SPATA6L antikoerper

Hintergrund: The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 45 kDa (MW of target protein)