C9orf68 Antikörper (Middle Region)

Produktnummer ABIN632882

Der Kaninchen-Polyklonal Anti-C9orf68-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von C9orf68 in Proben aus Human. }

Kurzübersicht für C9orf68 Antikörper (Middle Region) (ABIN632882)

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C9orf68 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C9orf68 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C9 ORF68 antibody was raised against the middle region of C9 rf68

Aufreinigung: Affinity purified

Immunogen: C9 ORF68 antibody was raised using the middle region of C9 rf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF68 Blocking Peptide, (ABIN937119), is also available for use as a blocking control in assays to test for specificity of this C9ORF68 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF68 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C9orf68

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Andere Bezeichnung: C9ORF68

Hintergrund: The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 45 kDa (MW of target protein)