Chromosome 1 Open Reading Frame 190 (C1orf190) (Middle Region) Antikörper

Produktnummer ABIN632875

Produktdetails

Target: Chromosome 1 Open Reading Frame 190 (C1orf190)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF190 antibody was raised against the middle region of C1 rf190

Aufreinigung: Affinity purified

Immunogen: C1 ORF190 antibody was raised using the middle region of C1 rf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF190 Blocking Peptide, catalog no. 33R-8527, is also available for use as a blocking control in assays to test for specificity of this C1ORF190 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF190 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Chromosome 1 Open Reading Frame 190 (C1orf190)

Andere Bezeichnung: C1ORF190 (C1orf190 Produkte)

Synonyme: C8H1orf190 antikoerper, C1orf190 antikoerper, LRAP35a antikoerper, LRP35A antikoerper, Lrp35a antikoerper, RGD1566001 antikoerper, 1520402A15Rik antikoerper, leucine rich adaptor protein 1 antikoerper, LURAP1 antikoerper, lurap1 antikoerper, Lurap1 antikoerper

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 26 kDa (MW of target protein)