CHAC2 Antikörper
-
- Target Alle CHAC2 Antikörper anzeigen
- CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHAC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV
- Top Product
- Discover our top product CHAC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHAC2 Blocking Peptide, catalog no. 33R-6622, is also available for use as a blocking control in assays to test for specificity of this CHAC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))
- Andere Bezeichnung
- CHAC2 (CHAC2 Produkte)
- Synonyme
- 2510006C20Rik antikoerper, chac antikoerper, fj84c08 antikoerper, im:7150709 antikoerper, wu:fj84c08 antikoerper, zgc:110055 antikoerper, RGD1309120 antikoerper, ChaC cation transport regulator homolog 2 antikoerper, ChaC, cation transport regulator homolog 2 antikoerper, ChaC, cation transport regulator 2 antikoerper, ChaC, cation transport regulator homolog 2 S homeolog antikoerper, ChaC, cation transport regulator homolog 2 (E. coli) antikoerper, ChaC cation transport regulator 2 antikoerper, CHAC2 antikoerper, chac2 antikoerper, Chac2 antikoerper, chac2.S antikoerper
- Hintergrund
- The function of CHAC protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 21 kDa (MW of target protein)
-