CHAC2 Antikörper

Produktnummer ABIN632873

Der Kaninchen-Polyklonal Anti-CHAC2-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von CHAC2 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für CHAC2 Antikörper (ABIN632873)

Target: CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHAC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHAC2 Antikörper

Aufreinigung: Affinity purified

Immunogen: CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHAC2 Blocking Peptide, (ABIN5612834), is also available for use as a blocking control in assays to test for specificity of this CHAC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHAC2

Target: CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))

Andere Bezeichnung: CHAC2

Hintergrund: The function of CHAC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 21 kDa (MW of target protein)