ODF2L Antikörper (N-Term)

Produktnummer ABIN632872

Produktdetails anti-ODF2L Antikörper

Target: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ODF2L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ODF2 L antibody was raised against the N terminal of ODF2

Aufreinigung: Affinity purified

Immunogen: ODF2 L antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ODF2L Blocking Peptide, catalog no. 33R-4698, is also available for use as a blocking control in assays to test for specificity of this ODF2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ODF2L

Target: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Andere Bezeichnung: ODF2L (ODF2L Produkte)

Synonyme: im:7137744 antikoerper, wu:fc04b05 antikoerper, RP5-977L11.1 antikoerper, dJ977L11.1 antikoerper, 4733401D09Rik antikoerper, 9630045K08Rik antikoerper, D3Ertd250e antikoerper, RGD1308397 antikoerper, outer dense fiber of sperm tails 2 like antikoerper, outer dense fiber of sperm tails 2b antikoerper, outer dense fiber protein 2-like antikoerper, outer dense fiber of sperm tails 2-like antikoerper, outer dense fiber of sperm tails 2-like L homeolog antikoerper, ODF2L antikoerper, odf2b antikoerper, LOC100366442 antikoerper, Odf2l antikoerper, odf2l.L antikoerper

Hintergrund: The function of ODF2L protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 60 kDa (MW of target protein)