C1orf103 Antikörper (N-Term)

Produktnummer ABIN632871

Dieses Anti-C1orf103-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von C1orf103 in WB. Geeignet für Human.

Kurzübersicht für C1orf103 Antikörper (N-Term) (ABIN632871)

Target: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf103 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C1orf103 Antikörper

Bindungsspezifität: N-Term

Spezifität: C1 ORF103 antibody was raised against the N terminal Of C1 rf103

Aufreinigung: Affinity purified

Immunogen: C1 ORF103 antibody was raised using the N terminal Of C1 rf103 corresponding to a region with amino acids KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF103 Blocking Peptide, (ABIN939858), is also available for use as a blocking control in assays to test for specificity of this C1ORF103 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF103 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf103

Target: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Andere Bezeichnung: C1ORF103

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Nuclear Hormone Receptor Binding