VPS54 Antikörper

Produktnummer ABIN632870

Der Kaninchen Polyklonal anti-VPS54 Antikörper wird verwendet zum Nachweis von VPS54 in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für VPS54 Antikörper (ABIN632870)

Target: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VPS54 Antikörper

Aufreinigung: Affinity purified

Immunogen: VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS54 Blocking Peptide, (ABIN938397), is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS54

Target: VPS54 (Vacuolar Protein Sorting 54 Homolog (VPS54))

Andere Bezeichnung: VPS54

Hintergrund: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi. This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molekulargewicht: 107 kDa (MW of target protein)