DDI1 Antikörper

Produktnummer ABIN632869

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DDI1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DDI1 Antikörper (ABIN632869)

Target: DDI1 (DNA-Damage Inducible 1 Homolog 1 (DDI1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDI1 Antikörper

Aufreinigung: Affinity purified

Immunogen: DDI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDI1 Blocking Peptide, (ABIN939962), is also available for use as a blocking control in assays to test for specificity of this DDI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDI1

Target: DDI1 (DNA-Damage Inducible 1 Homolog 1 (DDI1))

Andere Bezeichnung: DDI1

Hintergrund: The function of DDI1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 44 kDa (MW of target protein)