GADL1 Antikörper (Middle Region)

Produktnummer ABIN632859

Produktdetails anti-GADL1 Antikörper

Target: GADL1 (Glutamate Decarboxylase-Like 1 (GADL1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GADL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GADL1 antibody was raised against the middle region of GADL1

Aufreinigung: Affinity purified

Immunogen: GADL1 antibody was raised using the middle region of GADL1 corresponding to a region with amino acids SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GADL1 Blocking Peptide, catalog no. 33R-8292, is also available for use as a blocking control in assays to test for specificity of this GADL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GADL1

Target: GADL1 (Glutamate Decarboxylase-Like 1 (GADL1))

Andere Bezeichnung: GADL1 (GADL1 Produkte)

Synonyme: CSAD antikoerper, 1110027M19Rik antikoerper, RGD1565145 antikoerper, glutamate decarboxylase like 1 antikoerper, glutamate decarboxylase-like 1 antikoerper, GADL1 antikoerper, gadl1 antikoerper, Gadl1 antikoerper

Hintergrund: The function of GADL1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 38 kDa (MW of target protein)