IER5L Antikörper (Middle Region)

Produktnummer ABIN632857

Produktdetails anti-IER5L Antikörper

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IER5L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IER5 L antibody was raised against the middle region of IER5

Aufreinigung: Affinity purified

Immunogen: IER5 L antibody was raised using the middle region of IER5 corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IER5L Blocking Peptide, catalog no. 33R-8655, is also available for use as a blocking control in assays to test for specificity of this IER5L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IER5L

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Andere Bezeichnung: IER5L (IER5L Produkte)

Synonyme: 2610524G09Rik antikoerper, fe50b07 antikoerper, zgc:73321 antikoerper, zgc:77455 antikoerper, wu:fe50b07 antikoerper, bA247A12.2 antikoerper, MGC75980 antikoerper, immediate early response 5-like antikoerper, immediate early response 5 like antikoerper, immediate early response 5-like S homeolog antikoerper, immediate early response 2 antikoerper, Ier5l antikoerper, ier5l antikoerper, IER5L antikoerper, ier5l.S antikoerper, IER2 antikoerper

Hintergrund: The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)