IER5L Antikörper (Middle Region)

Produktnummer ABIN632857

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch IER5L in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für IER5L Antikörper (Middle Region) (ABIN632857)

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IER5L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IER5L Antikörper

Bindungsspezifität: Middle Region

Spezifität: IER5 L antibody was raised against the middle region of IER5

Aufreinigung: Affinity purified

Immunogen: IER5 L antibody was raised using the middle region of IER5 corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IER5L Blocking Peptide, (ABIN5614139), is also available for use as a blocking control in assays to test for specificity of this IER5L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IER5L

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Andere Bezeichnung: IER5L

Hintergrund: The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)