HEATR4 Antikörper (N-Term)

Produktnummer ABIN632853

Produktdetails anti-HEATR4 Antikörper

Target: HEATR4 (HEAT Repeat Containing 4 (HEATR4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HEATR4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HEATR4 antibody was raised against the N terminal of HEATR4

Aufreinigung: Affinity purified

Immunogen: HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HEATR4 Blocking Peptide, catalog no. 33R-9524, is also available for use as a blocking control in assays to test for specificity of this HEATR4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEATR4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HEATR4

Target: HEATR4 (HEAT Repeat Containing 4 (HEATR4))

Andere Bezeichnung: HEATR4 (HEATR4 Produkte)

Synonyme: HEAT repeat containing 4 antikoerper, HEATR4 antikoerper

Hintergrund: The function of the HEATR4 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 112 kDa (MW of target protein)