C3orf62 Antikörper (Middle Region)
-
- Target Alle C3orf62 Produkte
- C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C3orf62 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C3 ORF62 antibody was raised against the middle region of C3 rf62
- Aufreinigung
- Affinity purified
- Immunogen
- C3 ORF62 antibody was raised using the middle region of C3 rf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C3ORF62 Blocking Peptide, catalog no. 33R-3915, is also available for use as a blocking control in assays to test for specificity of this C3ORF62 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF62 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))
- Andere Bezeichnung
- C3ORF62 (C3orf62 Produkte)
- Synonyme
- chromosome 3 open reading frame 62 antikoerper, C3orf62 antikoerper
- Hintergrund
- The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 30 kDa (MW of target protein)
-