HDDC3 Antikörper (Middle Region)

Produktnummer ABIN632847

Der Kaninchen Polyklonal anti-HDDC3 Antikörper (ABIN632847) detektiert spezifisch HDDC3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für HDDC3 Antikörper (Middle Region) (ABIN632847)

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HDDC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HDDC3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HDDC3 antibody was raised against the middle region of HDDC3

Aufreinigung: Affinity purified

Immunogen: HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HDDC3 Blocking Peptide, (ABIN5613976), is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HDDC3

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Andere Bezeichnung: HDDC3

Hintergrund: The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 16 kDa (MW of target protein)