GANC Antikörper (Middle Region)

Produktnummer ABIN632846

Produktdetails anti-GANC Antikörper

Target: GANC (Glucosidase, Alpha, Neutral C (GANC))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GANC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GANC antibody was raised against the middle region of GANC

Aufreinigung: Affinity purified

Immunogen: GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GANC Blocking Peptide, catalog no. 33R-9658, is also available for use as a blocking control in assays to test for specificity of this GANC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GANC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GANC

Target: GANC (Glucosidase, Alpha, Neutral C (GANC))

Andere Bezeichnung: GANC (GANC Produkte)

Synonyme: 5830445O15Rik antikoerper, 9330160A12 antikoerper, mFLJ00088 antikoerper, glucosidase alpha, neutral C antikoerper, calpain-3 antikoerper, glucosidase, alpha; neutral C antikoerper, GANC antikoerper, LOC453361 antikoerper, ganc antikoerper, Ganc antikoerper

Hintergrund: GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.

Molekulargewicht: 104 kDa (MW of target protein)