WDR53 Antikörper (Middle Region)

Produktnummer ABIN632845

Produktdetails anti-WDR53 Antikörper

Target: WDR53 (WD Repeat Domain 53 (WDR53))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR53 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR53 antibody was raised against the middle region of WDR53

Aufreinigung: Affinity purified

Immunogen: WDR53 antibody was raised using the middle region of WDR53 corresponding to a region with amino acids NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR53 Blocking Peptide, catalog no. 33R-6765, is also available for use as a blocking control in assays to test for specificity of this WDR53 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR53 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR53

Target: WDR53 (WD Repeat Domain 53 (WDR53))

Andere Bezeichnung: WDR53 (WDR53 Produkte)

Synonyme: 1500002B03Rik antikoerper, AI848860 antikoerper, RGD1559546 antikoerper, WD repeat domain 53 antikoerper, WDR53 antikoerper, Wdr53 antikoerper

Hintergrund: The function of WDR53 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)