FAM131C Antikörper (Middle Region)

Produktnummer ABIN632844

Produktdetails anti-FAM131C Antikörper

Target: FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM131C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM131 C antibody was raised against the middle region of FAM131

Aufreinigung: Affinity purified

Immunogen: FAM131 C antibody was raised using the middle region of FAM131 corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM131C Blocking Peptide, catalog no. 33R-7936, is also available for use as a blocking control in assays to test for specificity of this FAM131C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM131C

Target: FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))

Andere Bezeichnung: FAM131C (FAM131C Produkte)

Synonyme: C1orf117 antikoerper, RP11-5P18.9 antikoerper, Gm693 antikoerper, family with sequence similarity 131 member C antikoerper, family with sequence similarity 131, member C antikoerper, FAM131C antikoerper, Fam131c antikoerper

Hintergrund: The function of FAM131 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)