FAM131C Antikörper (Middle Region)
-
- Target Alle FAM131C Produkte
- FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))
- Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM131C Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- FAM131 C antibody was raised against the middle region of FAM131
- Aufreinigung
- Affinity purified
- Immunogen
- FAM131 C antibody was raised using the middle region of FAM131 corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM131C Blocking Peptide, catalog no. 33R-7936, is also available for use as a blocking control in assays to test for specificity of this FAM131C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))
- Andere Bezeichnung
- FAM131C (FAM131C Produkte)
- Hintergrund
- The function of FAM131 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 30 kDa (MW of target protein)
-