LYPD5 Antikörper (N-Term)

Produktnummer ABIN632843

Der Kaninchen-Polyklonal Anti-LYPD5-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von LYPD5 in Proben aus Human. }

Kurzübersicht für LYPD5 Antikörper (N-Term) (ABIN632843)

Target: LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYPD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LYPD5 Antikörper

Bindungsspezifität: N-Term

Spezifität: LYPD5 antibody was raised against the N terminal of LYPD5

Aufreinigung: Affinity purified

Immunogen: LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYPD5 Blocking Peptide, (ABIN935978), is also available for use as a blocking control in assays to test for specificity of this LYPD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYPD5

Target: LYPD5 (LY6/PLAUR Domain Containing 5 (LYPD5))

Andere Bezeichnung: LYPD5

Hintergrund: The function of LYPD5 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 22 kDa (MW of target protein)