C1ORF110 Antikörper (Middle Region)

Produktnummer ABIN632841

Dieser Anti-C1ORF110 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von C1ORF110 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für C1ORF110 Antikörper (Middle Region) (ABIN632841)

Target: C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1ORF110 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C1ORF110 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C1 ORF110 antibody was raised against the middle region of C1 rf110

Aufreinigung: Affinity purified

Immunogen: C1 ORF110 antibody was raised using the middle region of C1 rf110 corresponding to a region with amino acids SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF110 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this C1ORF110 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF110 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1ORF110

Target: C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))

Andere Bezeichnung: C1ORF110

Hintergrund: The function of C1orf110 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 34 kDa (MW of target protein)