KRT18P55 Antikörper (N-Term)

Produktnummer ABIN632836

Produktdetails anti-KRT18P55 Antikörper

Target: KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRT18P55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FLJ40504 antibody was raised against the N terminal of FLJ40504

Aufreinigung: Affinity purified

Immunogen: FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ40504 Blocking Peptide, catalog no. 33R-5837, is also available for use as a blocking control in assays to test for specificity of this FLJ40504 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ40504 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRT18P55

Target: KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))

Andere Bezeichnung: FLJ40504 (KRT18P55 Produkte)

Synonyme: keratin 18 pseudogene 55 antikoerper, KRT18P55 antikoerper

Hintergrund: The specific function of FFLJ40504 is not yet known.

Molekulargewicht: 29 kDa (MW of target protein)