FAM98B Antikörper (N-Term)

Produktnummer ABIN632834

Der Kaninchen Polyklonal anti-FAM98B Antikörper wird verwendet zum Nachweis von FAM98B in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für FAM98B Antikörper (N-Term) (ABIN632834)

Target: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM98B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM98B Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM98 B antibody was raised against the N terminal of FAM98

Aufreinigung: Affinity purified

Immunogen: FAM98 B antibody was raised using the N terminal of FAM98 corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM98B Blocking Peptide, (ABIN5613513), is also available for use as a blocking control in assays to test for specificity of this FAM98B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM98B

Target: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Andere Bezeichnung: FAM98B

Hintergrund: The specific function of FAM98B is not yet known.

Molekulargewicht: 45 kDa (MW of target protein)