TRIML2 Antikörper (Middle Region)

Produktnummer ABIN632830

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TRIML2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für TRIML2 Antikörper (Middle Region) (ABIN632830)

Target: TRIML2 (Tripartite Motif Family-Like 2 (TRIML2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIML2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRIML2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TRIML2 antibody was raised against the middle region of TRIML2

Aufreinigung: Affinity purified

Immunogen: TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIML2 Blocking Peptide, (ABIN5616791), is also available for use as a blocking control in assays to test for specificity of this TRIML2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIML2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIML2

Target: TRIML2 (Tripartite Motif Family-Like 2 (TRIML2))

Andere Bezeichnung: TRIML2

Hintergrund: The specific function of TRIML2 is not yet known.

Molekulargewicht: 44 kDa (MW of target protein)