EML3 Antikörper (N-Term)

Produktnummer ABIN632829

Produktdetails anti-EML3 Antikörper

Target: EML3 (Echinoderm Microtubule Associated Protein Like 3 (EML3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EML3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EML3 antibody was raised against the N terminal of EML3

Aufreinigung: Affinity purified

Immunogen: EML3 antibody was raised using the N terminal of EML3 corresponding to a region with amino acids LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EML3 Blocking Peptide, catalog no. 33R-5198, is also available for use as a blocking control in assays to test for specificity of this EML3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EML3

Target: EML3 (Echinoderm Microtubule Associated Protein Like 3 (EML3))

Andere Bezeichnung: EML3 (EML3 Produkte)

Synonyme: BC022146 antikoerper, ELP95 antikoerper, RGD1311368 antikoerper, echinoderm microtubule associated protein like 3 antikoerper, Eml3 antikoerper, EML3 antikoerper

Hintergrund: EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Molekulargewicht: 95 kDa (MW of target protein)