PXT1 Antikörper (Middle Region)

Produktnummer ABIN632826

Dieses Anti-PXT1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PXT1 in WB. Geeignet für Human.

Kurzübersicht für PXT1 Antikörper (Middle Region) (ABIN632826)

Target: PXT1 (Peroxisomal, Testis Specific 1 (PXT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PXT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PXT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PXT1 antibody was raised against the middle region of PXT1

Aufreinigung: Affinity purified

Immunogen: PXT1 antibody was raised using the middle region of PXT1 corresponding to a region with amino acids MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PXT1 Blocking Peptide, (ABIN5615689), is also available for use as a blocking control in assays to test for specificity of this PXT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PXT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PXT1

Target: PXT1 (Peroxisomal, Testis Specific 1 (PXT1))

Andere Bezeichnung: PXT1

Hintergrund: The function of PXT1 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 6 kDa (MW of target protein)