Cfap299 Antikörper (N-Term)

Produktnummer ABIN632825

Der Kaninchen Polyklonal anti-Cfap299 Antikörper wird verwendet zum Nachweis von Cfap299 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für Cfap299 Antikörper (N-Term) (ABIN632825)

Target: Cfap299 (Cilia and Flagella Associated Protein 299 (Cfap299))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cfap299 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cfap299 Antikörper

Bindungsspezifität: N-Term

Spezifität: C4 ORF22 antibody was raised against the N terminal Of C4 rf22

Aufreinigung: Affinity purified

Immunogen: C4 ORF22 antibody was raised using the N terminal Of C4 rf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4ORF22 Blocking Peptide, (ABIN936131), is also available for use as a blocking control in assays to test for specificity of this C4ORF22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cfap299

Target: Cfap299 (Cilia and Flagella Associated Protein 299 (Cfap299))

Andere Bezeichnung: C4ORF22

Hintergrund: The specific function of C4orf22 is not yet known.

Molekulargewicht: 27 kDa (MW of target protein)