AKD1 Antikörper (N-Term)

Produktnummer ABIN632823

Der Kaninchen Polyklonal anti-AKD1 Antikörper (ABIN632823) detektiert spezifisch AKD1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für AKD1 Antikörper (N-Term) (ABIN632823)

Target: AKD1 (ADK1) (Adenylate Kinase Domain Containing 1 (ADK1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AKD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: C6 ORF199 antibody was raised against the N terminal Of C6 rf199

Aufreinigung: Affinity purified

Immunogen: C6 ORF199 antibody was raised using the N terminal Of C6 rf199 corresponding to a region with amino acids TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF199 Blocking Peptide, (ABIN5612536), is also available for use as a blocking control in assays to test for specificity of this C6ORF199 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF199 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKD1

Target: AKD1 (ADK1) (Adenylate Kinase Domain Containing 1 (ADK1))

Andere Bezeichnung: C6ORF199

Hintergrund: The function of the C6orf199 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 48 kDa (MW of target protein)